PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr032528.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 344aa    MW: 37943.2 Da    PI: 8.0173
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr032528.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.74.8e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd  lv +++++G+g+W++++   g++R+ k+c++rw +yl
      Pbr032528.1 14 KGPWTPEEDISLVSYIQEHGPGNWRAVPTNTGLHRCSKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding48.32.3e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T  E++ ++++ ++lG++ W++Ia++++  Rt++++k++w+++l
      Pbr032528.1  67 RGNFTDHEEKMIIHLQALLGNR-WAAIASYLP-QRTDNDIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.4E-24564IPR009057Homeodomain-like
PROSITE profilePS5129425.039965IPR017930Myb domain
SuperFamilySSF466891.68E-3011108IPR009057Homeodomain-like
SMARTSM007174.0E-141363IPR001005SANT/Myb domain
PfamPF002499.5E-161461IPR001005SANT/Myb domain
CDDcd001676.81E-111661No hitNo description
Gene3DG3DSA:1.10.10.601.8E-2465117IPR009057Homeodomain-like
PROSITE profilePS5129419.266116IPR017930Myb domain
SMARTSM007175.5E-1566114IPR001005SANT/Myb domain
PfamPF002499.0E-1467112IPR001005SANT/Myb domain
CDDcd001675.31E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MGRPPCCDKE GVKKGPWTPE EDISLVSYIQ EHGPGNWRAV PTNTGLHRCS KSCRLRWTNY  60
LRPGIKRGNF TDHEEKMIIH LQALLGNRWA AIASYLPQRT DNDIKNYWNT HLRKKLIKLQ  120
AAGGGTEGLH SKDQGNSNSS SQAISRGQWE RRLQTDIHMA RQALRDALSP EKPLALSSDL  180
NPADGFSISN LKKPTLDQSS NSTYASSTEN ISRLLKGWMK NPPKKSARLT NLANNQTDYQ  240
HYSSSEGTTS VANTANSGNV ELSDTFESLF GFESSNSDLS PSTSPEASLF QGESKPDLTS  300
DQLPLSFLEK WLFDEGAAAA AALGKYHFFS DMVIPDHGNA NIF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C3e-26141164105C-Myb DNA-Binding Domain
1msf_C3e-26141164105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP2295701e-111KP229570.1 UNVERIFIED: Boehmeria nivea MYB transcription factor-like (MYB14) mRNA, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009341011.10.0PREDICTED: myb-related protein 306-like
SwissprotP813921e-113MYB06_ANTMA; Myb-related protein 306
TrEMBLD9ZJ580.0D9ZJ58_MALDO; MYB domain class transcription factor
STRINGVIT_14s0108g00830.t011e-143(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101634115
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47600.11e-108myb domain protein 94